Lineage for d1yaum1 (1yau M:1-203)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735798Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 735799Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 735943Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 736244Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 736253Species Archaeon Thermoplasma acidophilum [TaxId:2303] [56253] (4 PDB entries)
  8. 736273Domain d1yaum1: 1yau M:1-203 [122863]
    Other proteins in same PDB: d1yaua1, d1yaub1, d1yauc1, d1yaud1, d1yaue1, d1yauf1, d1yaug1
    automatically matched to d1pma1_
    complexed with gol, so4; mutant

Details for d1yaum1

PDB Entry: 1yau (more details), 2.4 Å

PDB Description: structure of archeabacterial 20s proteasome- pa26 complex
PDB Compounds: (M:) Proteasome beta subunit

SCOP Domain Sequences for d1yaum1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yaum1 d.153.1.4 (M:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil

SCOP Domain Coordinates for d1yaum1:

Click to download the PDB-style file with coordinates for d1yaum1.
(The format of our PDB-style files is described here.)

Timeline for d1yaum1: