Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
Protein Proteasome beta subunit (catalytic) [56252] (5 species) |
Species Archaeon Thermoplasma acidophilum [TaxId:2303] [56253] (4 PDB entries) |
Domain d1yauk1: 1yau K:1-203 [122861] Other proteins in same PDB: d1yaua1, d1yaub1, d1yauc1, d1yaud1, d1yaue1, d1yauf1, d1yaug1 automatically matched to d1pma1_ complexed with gol, so4; mutant |
PDB Entry: 1yau (more details), 2.4 Å
SCOP Domain Sequences for d1yauk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yauk1 d.153.1.4 (K:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr kdgyvqlptdqiesrirklglil
Timeline for d1yauk1: