| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
| Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
| Protein automated matches [190144] (7 species) not a true protein |
| Species Thermoplasma acidophilum [TaxId:2303] [186869] (7 PDB entries) |
| Domain d1yauh_: 1yau H: [122858] Other proteins in same PDB: d1yauo_, d1yaup_, d1yauq_, d1yaur_, d1yaus_, d1yaut_, d1yauu_ automated match to d1pma1_ complexed with gol, so4 |
PDB Entry: 1yau (more details), 2.4 Å
SCOPe Domain Sequences for d1yauh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yauh_ d.153.1.4 (H:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil
Timeline for d1yauh_: