Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species) contains an extension to the common fold at the N-terminus |
Species Archaeon Thermoplasma acidophilum [TaxId:2303] [56256] (6 PDB entries) |
Domain d1yaue1: 1yau E:13-233 [122855] Other proteins in same PDB: d1yauh1, d1yaui1, d1yauj1, d1yauk1, d1yaul1, d1yaum1, d1yaun1, d1yauo1, d1yaup1, d1yauq1, d1yaur1, d1yaus1, d1yaut1, d1yauu1 automatically matched to d1pmaa_ complexed with gol, so4; mutant |
PDB Entry: 1yau (more details), 2.4 Å
SCOP Domain Sequences for d1yaue1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yaue1 d.153.1.4 (E:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
Timeline for d1yaue1: