Lineage for d1yaua1 (1yau A:13-233)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875596Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 875597Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 875747Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 875859Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species)
    contains an extension to the common fold at the N-terminus
  7. 875875Species Archaeon Thermoplasma acidophilum [TaxId:2303] [56256] (6 PDB entries)
  8. 875890Domain d1yaua1: 1yau A:13-233 [122851]
    Other proteins in same PDB: d1yauh1, d1yaui1, d1yauj1, d1yauk1, d1yaul1, d1yaum1, d1yaun1, d1yauo1, d1yaup1, d1yauq1, d1yaur1, d1yaus1, d1yaut1, d1yauu1
    automatically matched to d1pmaa_
    complexed with gol, so4; mutant

Details for d1yaua1

PDB Entry: 1yau (more details), 2.4 Å

PDB Description: structure of archeabacterial 20s proteasome- pa26 complex
PDB Compounds: (A:) Proteasome alpha subunit

SCOP Domain Sequences for d1yaua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yaua1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]}
tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
gikalkssleegeelkapeiasitvgnkyriydqeevkkfl

SCOP Domain Coordinates for d1yaua1:

Click to download the PDB-style file with coordinates for d1yaua1.
(The format of our PDB-style files is described here.)

Timeline for d1yaua1: