Lineage for d1yarm_ (1yar M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2995759Species Thermoplasma acidophilum [TaxId:2303] [186869] (4 PDB entries)
  8. 2995772Domain d1yarm_: 1yar M: [122849]
    Other proteins in same PDB: d1yaro_, d1yarp_, d1yarq_, d1yarr_, d1yars_, d1yart_, d1yaru_
    automated match to d1pma1_
    complexed with gol, so4; mutant

Details for d1yarm_

PDB Entry: 1yar (more details), 1.9 Å

PDB Description: structure of archeabacterial 20s proteasome mutant d9s- pa26 complex
PDB Compounds: (M:) Proteasome beta subunit

SCOPe Domain Sequences for d1yarm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yarm_ d.153.1.4 (M:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil

SCOPe Domain Coordinates for d1yarm_:

Click to download the PDB-style file with coordinates for d1yarm_.
(The format of our PDB-style files is described here.)

Timeline for d1yarm_: