Lineage for d1yarj1 (1yar J:1-203)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875596Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 875597Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 875747Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 876137Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 876146Species Archaeon Thermoplasma acidophilum [TaxId:2303] [56253] (6 PDB entries)
  8. 876149Domain d1yarj1: 1yar J:1-203 [122846]
    Other proteins in same PDB: d1yara1, d1yarb1, d1yarc1, d1yard1, d1yare1, d1yarf1, d1yarg1, d1yaro1, d1yarp1, d1yarq1, d1yarr1, d1yars1, d1yart1, d1yaru1
    automatically matched to d1pma1_
    complexed with gol, so4; mutant

Details for d1yarj1

PDB Entry: 1yar (more details), 1.9 Å

PDB Description: structure of archeabacterial 20s proteasome mutant d9s- pa26 complex
PDB Compounds: (J:) Proteasome beta subunit

SCOP Domain Sequences for d1yarj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yarj1 d.153.1.4 (J:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil

SCOP Domain Coordinates for d1yarj1:

Click to download the PDB-style file with coordinates for d1yarj1.
(The format of our PDB-style files is described here.)

Timeline for d1yarj1: