![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein automated matches [190144] (14 species) not a true protein |
![]() | Species Thermoplasma acidophilum [TaxId:2303] [186869] (4 PDB entries) |
![]() | Domain d1yarh_: 1yar H: [122844] Other proteins in same PDB: d1yaro_, d1yarp_, d1yarq_, d1yarr_, d1yars_, d1yart_, d1yaru_ automated match to d1pma1_ complexed with gol, so4; mutant |
PDB Entry: 1yar (more details), 1.9 Å
SCOPe Domain Sequences for d1yarh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yarh_ d.153.1.4 (H:) automated matches {Thermoplasma acidophilum [TaxId: 2303]} tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr kdgyvqlptdqiesrirklglil
Timeline for d1yarh_: