Lineage for d1yakd1 (1yak D:2-220)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777762Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 777763Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 777877Family a.132.1.3: TENA/THI-4 [101458] (8 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 777926Protein Transcriptional activator TenA [110030] (1 species)
  7. 777927Species Bacillus subtilis [TaxId:1423] [110031] (4 PDB entries)
    Uniprot P25052
  8. 777937Domain d1yakd1: 1yak D:2-220 [122836]
    automatically matched to d1to9a_
    complexed with hmh

Details for d1yakd1

PDB Entry: 1yak (more details), 2.5 Å

PDB Description: Complex of Bacillus subtilis TenA with 4-amino-2-methyl-5-hydroxymethylpyrimidine
PDB Compounds: (D:) Transcriptional activator tenA

SCOP Domain Sequences for d1yakd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yakd1 a.132.1.3 (D:2-220) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]}
kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay
akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl
sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde
laensteevrakmkenfvissyyeyqfwgmayrkegwsd

SCOP Domain Coordinates for d1yakd1:

Click to download the PDB-style file with coordinates for d1yakd1.
(The format of our PDB-style files is described here.)

Timeline for d1yakd1: