![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) ![]() duplication: contains two structural repeats of 3-helical motif |
![]() | Family a.132.1.3: TENA/THI-4 [101458] (8 proteins) Pfam PF03070; HO-related family lacking the heme-binding site |
![]() | Protein Transcriptional activator TenA [110030] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [110031] (4 PDB entries) Uniprot P25052 |
![]() | Domain d1yakd1: 1yak D:2-220 [122836] automatically matched to d1to9a_ complexed with hmh |
PDB Entry: 1yak (more details), 2.5 Å
SCOP Domain Sequences for d1yakd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yakd1 a.132.1.3 (D:2-220) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]} kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde laensteevrakmkenfvissyyeyqfwgmayrkegwsd
Timeline for d1yakd1: