SCOPe 2.08: Domain d1yakc_: 1yak C:

Lineage for d1yakc_ (1yak C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
   Pfam PF03070; HO-related family lacking the heme-binding site

6. Protein Transcriptional activator TenA [110030] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110031] (5 PDB entries)
   Uniprot P25052

8. Domain d1yakc_: 1yak C: [122835]
   automated match to d1to9a_
   complexed with hmh

Details for d1yakc_

PDB Entry: 1yak, 2.5 Å

PDB Description: Complex of Bacillus subtilis TenA with 4-amino-2-methyl-5-hydroxymethylpyrimidine

PDB Compounds: (C:) Transcriptional activator tenA

SCOPe Domain Sequences for d1yakc_:

Sequence; same for both SEQRES and ATOM records:

>d1yakc_ a.132.1.3 (C:) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]}
fseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaaya
kdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvls
gnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfdel
aensteevrakmkenfvissyyeyqfwgmayrkegwsdsa

Timeline for d1yakc_:

• d1yakc_ first appeared in SCOP 1.73, called d1yakc1
  
• d1yakc_ appears in SCOPe 2.07