Lineage for d1yakb_ (1yak B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011416Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2011417Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2011573Family a.132.1.3: TENA/THI-4 [101458] (9 protein domains)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 2011612Protein Transcriptional activator TenA [110030] (1 species)
  7. 2011613Species Bacillus subtilis [TaxId:1423] [110031] (5 PDB entries)
    Uniprot P25052
  8. 2011617Domain d1yakb_: 1yak B: [122834]
    automated match to d1to9a_
    complexed with hmh

Details for d1yakb_

PDB Entry: 1yak (more details), 2.5 Å

PDB Description: Complex of Bacillus subtilis TenA with 4-amino-2-methyl-5-hydroxymethylpyrimidine
PDB Compounds: (B:) Transcriptional activator tenA

SCOPe Domain Sequences for d1yakb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yakb_ a.132.1.3 (B:) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]}
kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay
akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl
sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde
laensteevrakmkenfvissyyeyqfwgmayrkegws

SCOPe Domain Coordinates for d1yakb_:

Click to download the PDB-style file with coordinates for d1yakb_.
(The format of our PDB-style files is described here.)

Timeline for d1yakb_: