SCOPe 2.05: Domain d1yahb_: 1yah B:

Lineage for d1yahb_ (1yah B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
   automatically mapped to Pfam PF00135

6. Protein automated matches [190065] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186857] (38 PDB entries)

8. Domain d1yahb_: 1yah B: [122819]
   automated match to d1mx9d_
   complexed with eee, nag, sia, so4

Details for d1yahb_

PDB Entry: 1yah, 3 Å

PDB Description: crystal structure of human liver carboxylesterase complexed to etyl acetate; a fatty acid ethyl ester analogue

PDB Compounds: (B:) CES1 protein

SCOPe Domain Sequences for d1yahb_:

Sequence; same for both SEQRES and ATOM records:

>d1yahb_ c.69.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak

Timeline for d1yahb_:

• d1yahb_ first appeared in SCOP 1.73, called d1yahb1
  
• d1yahb_ appears in SCOPe 2.04
  
• d1yahb_ appears in SCOPe 2.06
  
• d1yahb_ appears in the current release, SCOPe 2.08