Lineage for d1yaha_ (1yah A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2507027Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 2507362Protein automated matches [190065] (7 species)
    not a true protein
  7. 2507368Species Human (Homo sapiens) [TaxId:9606] [186857] (69 PDB entries)
  8. 2507432Domain d1yaha_: 1yah A: [122818]
    automated match to d1mx9d_
    complexed with eee, nag, sia, so4

Details for d1yaha_

PDB Entry: 1yah (more details), 3 Å

PDB Description: crystal structure of human liver carboxylesterase complexed to etyl acetate; a fatty acid ethyl ester analogue
PDB Compounds: (A:) CES1 protein

SCOPe Domain Sequences for d1yaha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yaha_ c.69.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak

SCOPe Domain Coordinates for d1yaha_:

Click to download the PDB-style file with coordinates for d1yaha_.
(The format of our PDB-style files is described here.)

Timeline for d1yaha_: