Class a: All alpha proteins [46456] (286 folds) |
Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) duplication: contains two structural repeats of 3-helical motif |
Family a.132.1.3: TENA/THI-4 [101458] (9 proteins) Pfam PF03070; HO-related family lacking the heme-binding site |
Protein Transcriptional activator TenA [110030] (1 species) |
Species Bacillus subtilis [TaxId:1423] [110031] (5 PDB entries) Uniprot P25052 |
Domain d1yafd_: 1yaf D: [122817] automated match to d1to9a_ |
PDB Entry: 1yaf (more details), 2.6 Å
SCOPe Domain Sequences for d1yafd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yafd_ a.132.1.3 (D:) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]} kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde laensteevrakmkenfvissyyeyqfwgmayrkegws
Timeline for d1yafd_: