Lineage for d1yafd1 (1yaf D:2-219)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648983Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 648984Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 649094Family a.132.1.3: TENA/THI-4 [101458] (8 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 649143Protein Transcriptional activator TenA [110030] (1 species)
  7. 649144Species Bacillus subtilis [TaxId:1423] [110031] (4 PDB entries)
  8. 649154Domain d1yafd1: 1yaf D:2-219 [122817]
    automatically matched to d1to9a_

Details for d1yafd1

PDB Entry: 1yaf (more details), 2.6 Å

PDB Description: Structure of TenA from Bacillus subtilis
PDB Compounds: (D:) Transcriptional activator tenA

SCOP Domain Sequences for d1yafd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yafd1 a.132.1.3 (D:2-219) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]}
kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay
akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl
sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde
laensteevrakmkenfvissyyeyqfwgmayrkegws

SCOP Domain Coordinates for d1yafd1:

Click to download the PDB-style file with coordinates for d1yafd1.
(The format of our PDB-style files is described here.)

Timeline for d1yafd1: