SCOP 1.73: Domain d1yafa1: 1yaf A:2-220

Lineage for d1yafa1 (1yaf A:2-220)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (8 proteins)
   Pfam PF03070; HO-related family lacking the heme-binding site

6. Protein Transcriptional activator TenA [110030] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110031] (4 PDB entries)

8. Domain d1yafa1: 1yaf A:2-220 [122814]
   automatically matched to d1to9a_

Details for d1yafa1

PDB Entry: 1yaf, 2.6 Å

PDB Description: Structure of TenA from Bacillus subtilis

PDB Compounds: (A:) Transcriptional activator tenA

SCOP Domain Sequences for d1yafa1:

Sequence; same for both SEQRES and ATOM records:

>d1yafa1 a.132.1.3 (A:2-220) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]}
kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay
akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl
sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde
laensteevrakmkenfvissyyeyqfwgmayrkegwsd

Timeline for d1yafa1:

• d1yafa1 is new in SCOP 1.73
  
• d1yafa1 appears in SCOP 1.75
  
• d1yafa1 appears in the current release, SCOPe 2.08, called d1yafa_