![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins) |
![]() | Protein Glutamate receptor ligand binding core [53881] (4 species) |
![]() | Species Rat (Rattus norvegicus), GluR6 [TaxId:10116] [142801] (6 PDB entries) |
![]() | Domain d1yaec1: 1yae C:423-544,C:669-802 [122811] automatically matched to 1YAE A:421-544,A:668-804 complexed with doq, fuc, nag |
PDB Entry: 1yae (more details), 3.11 Å
SCOP Domain Sequences for d1yaec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yaec1 c.94.1.1 (C:423-544,C:669-802) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR6 [TaxId: 10116]} nitdslsnrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirl vedgkygaqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisily rkXdsaddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegi qrvltsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailql qeegklhmmkekwwrgn
Timeline for d1yaec1:
![]() Domains from other chains: (mouse over for more information) d1yaea1, d1yaeb1, d1yaed1, d1yaee1 |