SCOP 1.73: Domain d1yaec1: 1yae C:423-544,C:669-802

Lineage for d1yaec1 (1yae C:423-544,C:669-802)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (4 species)

7. Species Rat (Rattus norvegicus), GluR6 [TaxId:10116] [142801] (6 PDB entries)

8. Domain d1yaec1: 1yae C:423-544,C:669-802 [122811]
   automatically matched to 1YAE A:421-544,A:668-804
   complexed with doq, fuc, nag

Details for d1yaec1

PDB Entry: 1yae, 3.11 Å

PDB Description: structure of the kainate receptor subunit glur6 agonist binding domain complexed with domoic acid

PDB Compounds: (C:) Glutamate receptor, ionotropic kainate 2

SCOP Domain Sequences for d1yaec1:

Sequence; same for both SEQRES and ATOM records:

>d1yaec1 c.94.1.1 (C:423-544,C:669-802) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR6 [TaxId: 10116]}
nitdslsnrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirl
vedgkygaqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisily
rkXdsaddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegi
qrvltsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailql
qeegklhmmkekwwrgn

Timeline for d1yaec1:

• d1yaec1 is new in SCOP 1.73
  
• d1yaec1 appears in SCOP 1.75
  
• d1yaec1 appears in the current release, SCOPe 2.08