Lineage for d1ya4b1 (1ya4 B:22-553)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134248Protein Mammalian carboxylesterase (liver carboxylesterase I) [75282] (2 species)
  7. 2134249Species Human (Homo sapiens) [TaxId:9606] [89768] (7 PDB entries)
  8. 2134279Domain d1ya4b1: 1ya4 B:22-553 [122788]
    automatically matched to d1mx9d_
    complexed with ctx, nag, sia, so4

Details for d1ya4b1

PDB Entry: 1ya4 (more details), 3.2 Å

PDB Description: Crystal Structure of Human Liver Carboxylesterase 1 in complex with tamoxifen
PDB Compounds: (B:) CES1 protein

SCOPe Domain Sequences for d1ya4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ya4b1 c.69.1.1 (B:22-553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]}
sppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvknat
syppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwihg
gglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwv
qdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgdv
kplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllgt
vidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsll
wksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdaga
ptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwan
farngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak

SCOPe Domain Coordinates for d1ya4b1:

Click to download the PDB-style file with coordinates for d1ya4b1.
(The format of our PDB-style files is described here.)

Timeline for d1ya4b1: