Lineage for d1ya0b_ (1ya0 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007337Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 protein domains)
  6. 2007457Protein automated matches [190103] (4 species)
    not a true protein
  7. 2007462Species Human (Homo sapiens) [TaxId:9606] [186825] (11 PDB entries)
  8. 2007474Domain d1ya0b_: 1ya0 B: [122786]
    Other proteins in same PDB: d1ya0a1
    automated match to d1ya0a1
    complexed with so4

Details for d1ya0b_

PDB Entry: 1ya0 (more details), 2.55 Å

PDB Description: Crystal structure of the N-terminal domain of human SMG7
PDB Compounds: (B:) SMG-7 transcript variant 2

SCOPe Domain Sequences for d1ya0b_:

Sequence, based on SEQRES records: (download)

>d1ya0b_ a.118.8.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mslqsaqylrqaevlkadmtdsklgpaevwtsrqalqdlyqkmlvtdleyaldkkveqdl
wnhafknqittlqgqaknranpnrsevqanlslfleaasgfytqllqelctvfnvdlpcr
vkssqlgiisnkqthtsaivkpqssscsyicqhclvhlgdiaryrnqtsqaesyyrhaaq
lvpsngqpynqlailasskgdhlttifyycrsiavkfpfpaastnlqkalskalesrdev
ktkwgvsdfikafikfhghvylsksleklsplrekleeqfkellfqkafnsqqlvhvtvi
nlfqlhhlrdfsneteqhtysqdeqlcwtqllalfmsflgilckcplqnesqeesynayp
lpavkvsmdwlrlrprvfqeavvderqyiwpwlisllnsfhpheedlssisatplpeefe
lqgflalrpsfrnldfskghqgitgdkegqqrrirqqrlisigkwiadnqprliqcenev
gkllfiteipeliledp

Sequence, based on observed residues (ATOM records): (download)

>d1ya0b_ a.118.8.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mslqsaqylrqaevlkadmtdsklgpaevwtsrqalqdlyqkmlvtdleyaldkkveqdl
wnhafknqittlqgqaknranpnrsevqanlslfleaasgfytqllqelctvfnvdlpcp
qssscsyicqhclvhlgdiaryrnqtsqaesyyrhaaqlvpsngqpynqlailasskgdh
lttifyycrsiavkfpfpaastnlqkalskalesrdevktkwgvsdfikafikfhghvyl
sksleklsplrekleeqfkellfqkafnsqqlvhvtvinlfqlhhlrdfsneteqhtysq
deqlcwtqllalfmsflgilckcplqneesynayplpavkvsmdwlrlrprvfqeavvde
rqyiwpwlisllnsfhpheedlssisatplpeefelqgflalrpsfrnldfskkegqqrr
irqqrlisigkwiadnqprliqcenevgkllfiteipeliledp

SCOPe Domain Coordinates for d1ya0b_:

Click to download the PDB-style file with coordinates for d1ya0b_.
(The format of our PDB-style files is described here.)

Timeline for d1ya0b_: