Lineage for d1y9wa1 (1y9w A:1-140)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. Protein Probable acetyltransferase BC2806 [143650] (1 species)
  7. Species Bacillus cereus [TaxId:1396] [143651] (1 PDB entry)
    Uniprot Q81CG1 1-140
  8. Domain d1y9wa1: 1y9w A:1-140 [122783]

Details for d1y9wa1

PDB Entry: 1y9w (more details), 1.9 Å

PDB Description: Structural Genomics, 1.9A crystal structure of an acetyltransferase from Bacillus cereus ATCC 14579
PDB Compounds: (A:) Acetyltransferase

SCOPe Domain Sequences for d1y9wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]}
mymkhiengtriegeyiknkviqynmsiltdevkqpmeevslvvkneegkifggvtgtmy
fyhlhidflwvdesvrhdgygsqllheiegiakekgcrlilldsfsfqapefykkhgyre
ygvvedhpkghsqhffekrl

SCOPe Domain Coordinates for d1y9wa1 are not available.

Timeline for d1y9wa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y9wb_