Lineage for d1y9ka1 (1y9k A:1-152)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870001Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 870002Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families) (S)
  5. 870003Family d.108.1.1: N-acetyl transferase, NAT [55730] (57 proteins)
  6. 870195Protein IAA acetyltransferase [143696] (1 species)
    YvbK ortholojg
  7. 870196Species Bacillus cereus [TaxId:1396] [143697] (1 PDB entry)
    Uniprot Q81FK8 1-152
  8. 870197Domain d1y9ka1: 1y9k A:1-152 [122779]

Details for d1y9ka1

PDB Entry: 1y9k (more details), 2.39 Å

PDB Description: IAA acetyltransferase from Bacillus cereus ATCC 14579
PDB Compounds: (A:) IAA acetyltransferase

SCOP Domain Sequences for d1y9ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]}
msvvieripkeaipkslllladpserqiatyvqrgltyvakqggsvigvyvlletrpktm
eimniavaehlqgkgigkkllrhavetakgygmsklevgtgnssvsqlalyqkcgfrifs
idfdyfskhyeeeiiengivcrdmirlameln

SCOP Domain Coordinates for d1y9ka1:

Click to download the PDB-style file with coordinates for d1y9ka1.
(The format of our PDB-style files is described here.)

Timeline for d1y9ka1: