![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
![]() | Family a.43.1.9: VCA0319-like [140553] (1 protein) COG4453; extended and extra C-terminal helices; potential component of the bi-partite system also including an acetyltransferase automatically mapped to Pfam PF08681 |
![]() | Protein Hypothetical protein VCA0482 (VCA0319) [140554] (1 species) Proteins of identical sequence, VCA0482 VCA0319 are encoded by two different genes |
![]() | Species Vibrio cholerae [TaxId:666] [140555] (1 PDB entry) Uniprot Q9K2J6 3-83 |
![]() | Domain d1y9bb_: 1y9b B: [122778] automated match to d1y9ba1 |
PDB Entry: 1y9b (more details), 2.2 Å
SCOPe Domain Sequences for d1y9bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y9bb_ a.43.1.9 (B:) Hypothetical protein VCA0482 (VCA0319) {Vibrio cholerae [TaxId: 666]} pritarvdvdtqdllakaaalagmssinsfvlnaaiekakqviereqalklsqadavllm ealdnpavvnaklklase
Timeline for d1y9bb_: