Lineage for d1y9bb_ (1y9b B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996372Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996373Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 1996543Family a.43.1.9: VCA0319-like [140553] (1 protein)
    COG4453; extended and extra C-terminal helices; potential component of the bi-partite system also including an acetyltransferase
    automatically mapped to Pfam PF08681
  6. 1996544Protein Hypothetical protein VCA0482 (VCA0319) [140554] (1 species)
    Proteins of identical sequence, VCA0482 VCA0319 are encoded by two different genes
  7. 1996545Species Vibrio cholerae [TaxId:666] [140555] (1 PDB entry)
    Uniprot Q9K2J6 3-83
  8. 1996547Domain d1y9bb_: 1y9b B: [122778]
    automated match to d1y9ba1

Details for d1y9bb_

PDB Entry: 1y9b (more details), 2.2 Å

PDB Description: Structure of Conserved Putative Transcriptional Factor from Vibrio cholerae O1 biovar eltor str. N16961
PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d1y9bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y9bb_ a.43.1.9 (B:) Hypothetical protein VCA0482 (VCA0319) {Vibrio cholerae [TaxId: 666]}
pritarvdvdtqdllakaaalagmssinsfvlnaaiekakqviereqalklsqadavllm
ealdnpavvnaklklase

SCOPe Domain Coordinates for d1y9bb_:

Click to download the PDB-style file with coordinates for d1y9bb_.
(The format of our PDB-style files is described here.)

Timeline for d1y9bb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y9ba1