SCOPe 2.06: Domain d1y9ba1: 1y9b A:3-83

Lineage for d1y9ba1 (1y9b A:3-83)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.9: VCA0319-like [140553] (1 protein)
   COG4453; extended and extra C-terminal helices; potential component of the bi-partite system also including an acetyltransferase
   automatically mapped to Pfam PF08681

6. Protein Hypothetical protein VCA0482 (VCA0319) [140554] (1 species)
   Proteins of identical sequence, VCA0482 VCA0319 are encoded by two different genes

7. Species Vibrio cholerae [TaxId:666] [140555] (1 PDB entry)
   Uniprot Q9K2J6 3-83

8. Domain d1y9ba1: 1y9b A:3-83 [122777]

Details for d1y9ba1

PDB Entry: 1y9b, 2.2 Å

PDB Description: Structure of Conserved Putative Transcriptional Factor from Vibrio cholerae O1 biovar eltor str. N16961

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1y9ba1:

Sequence; same for both SEQRES and ATOM records:

>d1y9ba1 a.43.1.9 (A:3-83) Hypothetical protein VCA0482 (VCA0319) {Vibrio cholerae [TaxId: 666]}
ttlpritarvdvdtqdllakaaalagmssinsfvlnaaiekakqviereqalklsqadav
llmealdnpavvnaklklase

Timeline for d1y9ba1:

• d1y9ba1 first appeared in SCOP 1.73
  
• d1y9ba1 appears in SCOPe 2.05
  
• d1y9ba1 appears in SCOPe 2.07
  
• d1y9ba1 appears in the current release, SCOPe 2.08