Class a: All alpha proteins [46456] (289 folds) |
Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
Family a.43.1.9: VCA0319-like [140553] (1 protein) COG4453; extended and extra C-terminal helices; potential component of the bi-partite system also including an acetyltransferase automatically mapped to Pfam PF08681 |
Protein Hypothetical protein VCA0482 (VCA0319) [140554] (1 species) Proteins of identical sequence, VCA0482 VCA0319 are encoded by two different genes |
Species Vibrio cholerae [TaxId:666] [140555] (1 PDB entry) Uniprot Q9K2J6 3-83 |
Domain d1y9ba1: 1y9b A:3-83 [122777] |
PDB Entry: 1y9b (more details), 2.2 Å
SCOPe Domain Sequences for d1y9ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y9ba1 a.43.1.9 (A:3-83) Hypothetical protein VCA0482 (VCA0319) {Vibrio cholerae [TaxId: 666]} ttlpritarvdvdtqdllakaaalagmssinsfvlnaaiekakqviereqalklsqadav llmealdnpavvnaklklase
Timeline for d1y9ba1: