SCOP 1.73: Domain d1y98a2: 1y98 A:1760-1855

Lineage for d1y98a2 (1y98 A:1760-1855)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.15: BRCT domain [52112] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.15.1: BRCT domain [52113] (5 families)
   Pfam PF00533

5. Family c.15.1.3: BRCT domain [63955] (1 protein)

6. Protein Breast cancer associated protein, BRCA1 [63956] (2 species)
   duplication: tandem repeat of BRCT domain

7. Species Rat (Rattus norvegicus) [TaxId:10116] [75147] (2 PDB entries)

8. Domain d1y98a2: 1y98 A:1760-1855 [122776]
   automatically matched to d1l0ba2
   complexed with co, so4

Details for d1y98a2

PDB Entry: 1y98, 2.5 Å

PDB Description: Structure of the BRCT repeats of BRCA1 bound to a CtIP phosphopeptide.

PDB Compounds: (A:) breast cancer type 1 susceptibility protein

SCOP Domain Sequences for d1y98a2:

Sequence; same for both SEQRES and ATOM records:

>d1y98a2 c.15.1.3 (A:1760-1855) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus) [TaxId: 10116]}
ifrgleiccygpftnmptdqlewmvqlcgasvvkelssftlgtgvhpivvvqpdawtedn
gfhaigqmceapvvtrewvldsvalyqcqeldtyli

Timeline for d1y98a2:

• d1y98a2 is new in SCOP 1.73
  
• d1y98a2 appears in SCOP 1.75
  
• d1y98a2 appears in the current release, SCOPe 2.08