Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.15: BRCT domain [52112] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.15.1: BRCT domain [52113] (6 families) Pfam PF00533 |
Family c.15.1.3: BRCT domain [63955] (1 protein) |
Protein Breast cancer associated protein, BRCA1 [63956] (2 species) duplication: tandem repeat of BRCT domain |
Species Human (Homo sapiens) [TaxId:9606] [63957] (15 PDB entries) Uniprot P38398 1649-1863 |
Domain d1y98a2: 1y98 A:1760-1855 [122776] automatically matched to d1l0ba2 complexed with co, so4 |
PDB Entry: 1y98 (more details), 2.5 Å
SCOPe Domain Sequences for d1y98a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y98a2 c.15.1.3 (A:1760-1855) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} ifrgleiccygpftnmptdqlewmvqlcgasvvkelssftlgtgvhpivvvqpdawtedn gfhaigqmceapvvtrewvldsvalyqcqeldtyli
Timeline for d1y98a2: