Lineage for d1y98a2 (1y98 A:1760-1855)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2854448Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2854449Superfamily c.15.1: BRCT domain [52113] (6 families) (S)
    Pfam PF00533
  5. 2854482Family c.15.1.3: BRCT domain [63955] (1 protein)
  6. 2854483Protein Breast cancer associated protein, BRCA1 [63956] (2 species)
    duplication: tandem repeat of BRCT domain
  7. 2854484Species Human (Homo sapiens) [TaxId:9606] [63957] (15 PDB entries)
    Uniprot P38398 1649-1863
  8. 2854490Domain d1y98a2: 1y98 A:1760-1855 [122776]
    automatically matched to d1l0ba2
    complexed with co, so4

Details for d1y98a2

PDB Entry: 1y98 (more details), 2.5 Å

PDB Description: Structure of the BRCT repeats of BRCA1 bound to a CtIP phosphopeptide.
PDB Compounds: (A:) breast cancer type 1 susceptibility protein

SCOPe Domain Sequences for d1y98a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y98a2 c.15.1.3 (A:1760-1855) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]}
ifrgleiccygpftnmptdqlewmvqlcgasvvkelssftlgtgvhpivvvqpdawtedn
gfhaigqmceapvvtrewvldsvalyqcqeldtyli

SCOPe Domain Coordinates for d1y98a2:

Click to download the PDB-style file with coordinates for d1y98a2.
(The format of our PDB-style files is described here.)

Timeline for d1y98a2: