Lineage for d1y98a1 (1y98 A:1650-1756)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691072Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 691073Superfamily c.15.1: BRCT domain [52113] (5 families) (S)
    Pfam PF00533
  5. 691086Family c.15.1.3: BRCT domain [63955] (1 protein)
  6. 691087Protein Breast cancer associated protein, BRCA1 [63956] (2 species)
    duplication: tandem repeat of BRCT domain
  7. 691110Species Rat (Rattus norvegicus) [TaxId:10116] [75147] (2 PDB entries)
  8. 691113Domain d1y98a1: 1y98 A:1650-1756 [122775]
    automatically matched to d1l0ba1
    complexed with co, so4

Details for d1y98a1

PDB Entry: 1y98 (more details), 2.5 Å

PDB Description: Structure of the BRCT repeats of BRCA1 bound to a CtIP phosphopeptide.
PDB Compounds: (A:) breast cancer type 1 susceptibility protein

SCOP Domain Sequences for d1y98a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y98a1 c.15.1.3 (A:1650-1756) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus) [TaxId: 10116]}
msmvvsgltpeefmlvykfarkhhitltnliteetthvvmktdaefvcertlkyflgiag
gkwvvsyfwvtqsikerkmlnehdfevrgdvvngrnhqgpkraresq

SCOP Domain Coordinates for d1y98a1:

Click to download the PDB-style file with coordinates for d1y98a1.
(The format of our PDB-style files is described here.)

Timeline for d1y98a1:

Domains from same chain:
(mouse over for more information)
d1y98a2