SCOPe 2.08: Domain d1y98a1: 1y98 A:1650-1756

Lineage for d1y98a1 (1y98 A:1650-1756)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.15: BRCT domain [52112] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.15.1: BRCT domain [52113] (6 families)
   Pfam PF00533

5. Family c.15.1.3: BRCT domain [63955] (1 protein)

6. Protein Breast cancer associated protein, BRCA1 [63956] (2 species)
   duplication: tandem repeat of BRCT domain

7. Species Human (Homo sapiens) [TaxId:9606] [63957] (15 PDB entries)
   Uniprot P38398 1649-1863

8. Domain d1y98a1: 1y98 A:1650-1756 [122775]
   automatically matched to d1l0ba1
   complexed with co, so4

Details for d1y98a1

PDB Entry: 1y98, 2.5 Å

PDB Description: Structure of the BRCT repeats of BRCA1 bound to a CtIP phosphopeptide.

PDB Compounds: (A:) breast cancer type 1 susceptibility protein

SCOPe Domain Sequences for d1y98a1:

Sequence; same for both SEQRES and ATOM records:

>d1y98a1 c.15.1.3 (A:1650-1756) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]}
msmvvsgltpeefmlvykfarkhhitltnliteetthvvmktdaefvcertlkyflgiag
gkwvvsyfwvtqsikerkmlnehdfevrgdvvngrnhqgpkraresq

Timeline for d1y98a1:

• d1y98a1 first appeared in SCOP 1.73
  
• d1y98a1 appears in SCOPe 2.07