Lineage for d1y97b_ (1y97 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2494311Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2494687Protein Three prime repair exonuclease 2, TREX2 [142499] (2 species)
  7. 2494688Species Human (Homo sapiens) [TaxId:9606] [142500] (1 PDB entry)
    Uniprot Q9BQ50 44-271
  8. 2494690Domain d1y97b_: 1y97 B: [122774]
    Other proteins in same PDB: d1y97a2
    automated match to d1y97a1

Details for d1y97b_

PDB Entry: 1y97 (more details), 2.5 Å

PDB Description: The human TREX2 3' exonuclease structure suggests a mechanism for efficient non-processive DNA catalysis
PDB Compounds: (B:) Three prime repair exonuclease 2

SCOPe Domain Sequences for d1y97b_:

Sequence, based on SEQRES records: (download)

>d1y97b_ c.55.3.5 (B:) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]}
eapraetfvfldleatglpsvepeiaelslfavhrsslenpehdesgalvlprvldkltl
cmcperpftakaseitglsseglarcrkagfdgavvrtlqaflsrqagpiclvahngfdy
dfpllcaelrrlgarlprdtvcldtlpalrgldrahshgtrargrqgyslgslfhryfra
epsaahsaegdvhtllliflhraaellawadeqargwahiepmylp

Sequence, based on observed residues (ATOM records): (download)

>d1y97b_ c.55.3.5 (B:) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]}
eapraetfvfldleatglpsvepeiaelslfavhrsslenpehdesgalvlprvldkltl
cmcperpftakaseitglsseglarcrkagfdgavvrtlqaflsrqagpiclvahngfdy
dfpllcaelrrlgarlprdtvcldtlpalrgldrgyslgslfhryfraephsaegdvhtl
lliflhraaellawadeqargwahiepmylp

SCOPe Domain Coordinates for d1y97b_:

Click to download the PDB-style file with coordinates for d1y97b_.
(The format of our PDB-style files is described here.)

Timeline for d1y97b_: