![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins) contains Pfam PF00929 |
![]() | Protein Three prime repair exonuclease 2, TREX2 [142499] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142500] (1 PDB entry) |
![]() | Domain d1y97b1: 1y97 B:3-228 [122774] automatically matched to 1Y97 A:1-228 |
PDB Entry: 1y97 (more details), 2.5 Å
SCOP Domain Sequences for d1y97b1:
Sequence, based on SEQRES records: (download)
>d1y97b1 c.55.3.5 (B:3-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]} eapraetfvfldleatglpsvepeiaelslfavhrsslenpehdesgalvlprvldkltl cmcperpftakaseitglsseglarcrkagfdgavvrtlqaflsrqagpiclvahngfdy dfpllcaelrrlgarlprdtvcldtlpalrgldrahshgtrargrqgyslgslfhryfra epsaahsaegdvhtllliflhraaellawadeqargwahiepmylp
>d1y97b1 c.55.3.5 (B:3-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]} eapraetfvfldleatglpsvepeiaelslfavhrsslenpehdesgalvlprvldkltl cmcperpftakaseitglsseglarcrkagfdgavvrtlqaflsrqagpiclvahngfdy dfpllcaelrrlgarlprdtvcldtlpalrgldrgyslgslfhryfraephsaegdvhtl lliflhraaellawadeqargwahiepmylp
Timeline for d1y97b1: