Lineage for d1y97b1 (1y97 B:3-228)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701966Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) (S)
    consists of one domain of this fold
  5. 702237Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins)
    contains Pfam PF00929
  6. 702437Protein Three prime repair exonuclease 2, TREX2 [142499] (1 species)
  7. 702438Species Human (Homo sapiens) [TaxId:9606] [142500] (1 PDB entry)
  8. 702440Domain d1y97b1: 1y97 B:3-228 [122774]
    automatically matched to 1Y97 A:1-228

Details for d1y97b1

PDB Entry: 1y97 (more details), 2.5 Å

PDB Description: The human TREX2 3' exonuclease structure suggests a mechanism for efficient non-processive DNA catalysis
PDB Compounds: (B:) Three prime repair exonuclease 2

SCOP Domain Sequences for d1y97b1:

Sequence, based on SEQRES records: (download)

>d1y97b1 c.55.3.5 (B:3-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]}
eapraetfvfldleatglpsvepeiaelslfavhrsslenpehdesgalvlprvldkltl
cmcperpftakaseitglsseglarcrkagfdgavvrtlqaflsrqagpiclvahngfdy
dfpllcaelrrlgarlprdtvcldtlpalrgldrahshgtrargrqgyslgslfhryfra
epsaahsaegdvhtllliflhraaellawadeqargwahiepmylp

Sequence, based on observed residues (ATOM records): (download)

>d1y97b1 c.55.3.5 (B:3-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]}
eapraetfvfldleatglpsvepeiaelslfavhrsslenpehdesgalvlprvldkltl
cmcperpftakaseitglsseglarcrkagfdgavvrtlqaflsrqagpiclvahngfdy
dfpllcaelrrlgarlprdtvcldtlpalrgldrgyslgslfhryfraephsaegdvhtl
lliflhraaellawadeqargwahiepmylp

SCOP Domain Coordinates for d1y97b1:

Click to download the PDB-style file with coordinates for d1y97b1.
(The format of our PDB-style files is described here.)

Timeline for d1y97b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y97a1