Lineage for d1y93a1 (1y93 A:106-263)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867614Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 867615Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) (S)
  5. 867875Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 867967Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 867968Species Human (Homo sapiens) [TaxId:9606] [69781] (18 PDB entries)
    Uniprot P39900 106-263
    Uniprot P39900 106-264
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 867969Domain d1y93a1: 1y93 A:106-263 [122772]
    automatically matched to d1os2a_
    complexed with ca, hae, zn; mutant

Details for d1y93a1

PDB Entry: 1y93 (more details), 1.03 Å

PDB Description: crystal structure of the catalytic domain of human mmp12 complexed with acetohydroxamic acid at atomic resolution
PDB Compounds: (A:) Macrophage metalloelastase

SCOP Domain Sequences for d1y93a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y93a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOP Domain Coordinates for d1y93a1:

Click to download the PDB-style file with coordinates for d1y93a1.
(The format of our PDB-style files is described here.)

Timeline for d1y93a1: