Lineage for d1y8xa1 (1y8x A:27-183)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546035Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2546043Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2546102Species Human (Homo sapiens), E2 M [TaxId:9606] [143058] (3 PDB entries)
    Uniprot P61081 27-183
    the extra N-terminal peptide, bound to the heterodimeric E1 enzyme for NEDD8, can be seen in the PDB entry 1tt5, chains E and F
  8. 2546103Domain d1y8xa1: 1y8x A:27-183 [122769]
    Other proteins in same PDB: d1y8xa2, d1y8xb1

Details for d1y8xa1

PDB Entry: 1y8x (more details), 2.4 Å

PDB Description: structural basis for recruitment of ubc12 by an e2-binding domain in nedd8's e1
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 M

SCOPe Domain Sequences for d1y8xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]}
asaaqlriqkdinelnlpktcdisfsdpddllnfklvicpdegfyksgkfvfsfkvgqgy
phdppkvkcetmvyhpnidlegnvclnilredwkpvltinsiiyglqylflepnpedpln
keaaevlqnnrrlfeqnvqrsmrggyigstyferclk

SCOPe Domain Coordinates for d1y8xa1:

Click to download the PDB-style file with coordinates for d1y8xa1.
(The format of our PDB-style files is described here.)

Timeline for d1y8xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y8xa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1y8xb1