![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (4 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (6 proteins) |
![]() | Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species) |
![]() | Species Human (Homo sapiens), E2 M [TaxId:9606] [143058] (1 PDB entry) the extra N-terminal peptide, bound to the heterodimeric E1 enzyme for NEDD8, can be seen in the PDB entry 1tt5, chains E and F |
![]() | Domain d1y8xa1: 1y8x A:27-183 [122769] |
PDB Entry: 1y8x (more details), 2.4 Å
SCOP Domain Sequences for d1y8xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} asaaqlriqkdinelnlpktcdisfsdpddllnfklvicpdegfyksgkfvfsfkvgqgy phdppkvkcetmvyhpnidlegnvclnilredwkpvltinsiiyglqylflepnpedpln keaaevlqnnrrlfeqnvqrsmrggyigstyferclk
Timeline for d1y8xa1: