Lineage for d1y8xa1 (1y8x A:27-183)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720005Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 720006Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 720007Family d.20.1.1: UBC-related [54496] (6 proteins)
  6. 720015Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species)
  7. 720060Species Human (Homo sapiens), E2 M [TaxId:9606] [143058] (1 PDB entry)
    the extra N-terminal peptide, bound to the heterodimeric E1 enzyme for NEDD8, can be seen in the PDB entry 1tt5, chains E and F
  8. 720061Domain d1y8xa1: 1y8x A:27-183 [122769]

Details for d1y8xa1

PDB Entry: 1y8x (more details), 2.4 Å

PDB Description: Structural basis for recruitment of Ubc12 by an E2-binding domain in NEDD8's E1
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 M

SCOP Domain Sequences for d1y8xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]}
asaaqlriqkdinelnlpktcdisfsdpddllnfklvicpdegfyksgkfvfsfkvgqgy
phdppkvkcetmvyhpnidlegnvclnilredwkpvltinsiiyglqylflepnpedpln
keaaevlqnnrrlfeqnvqrsmrggyigstyferclk

SCOP Domain Coordinates for d1y8xa1:

Click to download the PDB-style file with coordinates for d1y8xa1.
(The format of our PDB-style files is described here.)

Timeline for d1y8xa1: