Lineage for d1y8tb2 (1y8t B:6-226)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670184Family b.47.1.1: Prokaryotic proteases [50495] (15 proteins)
  6. 670297Protein Protease PepD [141383] (1 species)
  7. 670298Species Mycobacterium tuberculosis [TaxId:1773] [141384] (1 PDB entry)
    Rv0983
  8. 670300Domain d1y8tb2: 1y8t B:6-226 [122766]
    Other proteins in same PDB: d1y8ta1, d1y8tb1, d1y8tc1
    automatically matched to 1Y8T A:6-226

Details for d1y8tb2

PDB Entry: 1y8t (more details), 2 Å

PDB Description: Crystal Structure of RV0983 from Mycobacterium tuberculosis- Proteolytically active form
PDB Compounds: (B:) hypothetical protein Rv0983

SCOP Domain Sequences for d1y8tb2:

Sequence, based on SEQRES records: (download)

>d1y8tb2 b.47.1.1 (B:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]}
gsveqvaakvvpsvvmletdlgrqseegsgiilsaegliltnnhviaaaakpplgspppk
ttvtfsdgrtapftvvgadptsdiavvrvqgvsgltpislgsssdlrvgqpvlaigsplg
legtvttgivsalnrpvsttgeagnqntvldaiqtdaainpgnsggalvnmnaqlvgvns
aiatlgadsadaqsgsiglgfaipvdqakriadelistgka

Sequence, based on observed residues (ATOM records): (download)

>d1y8tb2 b.47.1.1 (B:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]}
gsveqvaakvvpsvvmletdseegsgiilsaegliltnnhviaaapkttvtfsdgrtapf
tvvgadptsdiavvrvqgvsgltpislgsssdlrvgqpvlaigsplglegtvttgivsal
nrpvstntvldaiqtdaainpgnsggalvnmnaqlvgvnsaiatlgaqsgsiglgfaipv
dqakriadelistgka

SCOP Domain Coordinates for d1y8tb2:

Click to download the PDB-style file with coordinates for d1y8tb2.
(The format of our PDB-style files is described here.)

Timeline for d1y8tb2: