![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
![]() | Protein Protease PepD [141383] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [141384] (2 PDB entries) Uniprot O53896 154-374 Rv0983 |
![]() | Domain d1y8tb2: 1y8t B:6-226 [122766] Other proteins in same PDB: d1y8ta1, d1y8tb1, d1y8tc1 automated match to d1y8ta2 |
PDB Entry: 1y8t (more details), 2 Å
SCOPe Domain Sequences for d1y8tb2:
Sequence, based on SEQRES records: (download)
>d1y8tb2 b.47.1.1 (B:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} gsveqvaakvvpsvvmletdlgrqseegsgiilsaegliltnnhviaaaakpplgspppk ttvtfsdgrtapftvvgadptsdiavvrvqgvsgltpislgsssdlrvgqpvlaigsplg legtvttgivsalnrpvsttgeagnqntvldaiqtdaainpgnsggalvnmnaqlvgvns aiatlgadsadaqsgsiglgfaipvdqakriadelistgka
>d1y8tb2 b.47.1.1 (B:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} gsveqvaakvvpsvvmletdseegsgiilsaegliltnnhviaaapkttvtfsdgrtapf tvvgadptsdiavvrvqgvsgltpislgsssdlrvgqpvlaigsplglegtvttgivsal nrpvstntvldaiqtdaainpgnsggalvnmnaqlvgvnsaiatlgaqsgsiglgfaipv dqakriadelistgka
Timeline for d1y8tb2:
![]() Domains from other chains: (mouse over for more information) d1y8ta1, d1y8ta2, d1y8tc1, d1y8tc2 |