Lineage for d1y8rf_ (1y8r F:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2502019Protein automated matches [190118] (13 species)
    not a true protein
  7. 2502050Species Human (Homo sapiens) [TaxId:9606] [189560] (90 PDB entries)
  8. 2502151Domain d1y8rf_: 1y8r F: [122762]
    automated match to d1a5r__
    complexed with atp, mg, zn

Details for d1y8rf_

PDB Entry: 1y8r (more details), 2.75 Å

PDB Description: sumo e1 activating enzyme sae1-sae2-sumo1-mg-atp complex
PDB Compounds: (F:) Ubiquitin-like protein SMT3C

SCOPe Domain Sequences for d1y8rf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y8rf_ d.15.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriad
nhtpkelgmeeedvievyqeqtgg

SCOPe Domain Coordinates for d1y8rf_:

Click to download the PDB-style file with coordinates for d1y8rf_.
(The format of our PDB-style files is described here.)

Timeline for d1y8rf_: