Class b: All beta proteins [48724] (174 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (1 family) 7 to 8 strands in 2 beta-sheets |
Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins) |
Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species) component of the pyruvate dehydrogenase complex |
Species Human (Homo sapiens) [TaxId:9606] [51242] (4 PDB entries) |
Domain d1y8ob1: 1y8o B:128-229 [122759] Other proteins in same PDB: d1y8oa1, d1y8oa2 automatically matched to d1fyc__ complexed with adp, k, lpa, mg |
PDB Entry: 1y8o (more details), 2.48 Å
SCOP Domain Sequences for d1y8ob1:
Sequence, based on SEQRES records: (download)
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla kilvpegtrdvplgtplciivekeadisafadyrptevtdlk
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla kilvpegtrdvplgtplciivekeadisafadytdlk
Timeline for d1y8ob1: