Lineage for d1y8ma1 (1y8m A:1-138)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. Protein Mitochondria fission protein Fis1 [101417] (2 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140836] (3 PDB entries)
    Uniprot P40515 1-138
  8. Domain d1y8ma1: 1y8m A:1-138 [122757]
    Other proteins in same PDB: d1y8ma2

Details for d1y8ma1

PDB Entry: 1y8m (more details)

PDB Description: Solution Structure of Yeast Mitochondria Fission Protein Fis1
PDB Compounds: (A:) Fis1

SCOPe Domain Sequences for d1y8ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y8ma1 a.118.8.1 (A:1-138) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtkvdfwptlkdayeplypqqleilrqqvvseggptatiqsrfnyawglikstdvnderl
gvkiltdiykeaesrrreclyyltigcyklgeysmakryvdtlfehernnkqvgalksmv
edkiqketlkgvvvaggv

SCOPe Domain Coordinates for d1y8ma1 are not available.

Timeline for d1y8ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y8ma2