Lineage for d1y8kc1 (1y8k C:1-141)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 631855Protein Hemoglobin, alpha-chain [46486] (19 species)
  7. 631914Species Horse (Equus caballus) [TaxId:9796] [46488] (9 PDB entries)
  8. 631920Domain d1y8kc1: 1y8k C:1-141 [122755]
    Other proteins in same PDB: d1y8kb1, d1y8kd1
    automatically matched to d1g0ba_
    complexed with hem

Details for d1y8kc1

PDB Entry: 1y8k (more details), 2.3 Å

PDB Description: Horse methemoglobin low salt, PH 7.0 (88% relative humidity)
PDB Compounds: (C:) Hemoglobin alpha chains

SCOP Domain Sequences for d1y8kc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y8kc1 a.1.1.2 (C:1-141) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOP Domain Coordinates for d1y8kc1:

Click to download the PDB-style file with coordinates for d1y8kc1.
(The format of our PDB-style files is described here.)

Timeline for d1y8kc1: