Lineage for d1y8ja1 (1y8j A:54-749)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729174Family d.92.1.4: Neutral endopeptidase (neprilysin) [55502] (1 protein)
  6. 729175Protein Neutral endopeptidase (neprilysin) [55503] (1 species)
    contains thermolysin-like catalytic domain (residues 419-749)
    the N-terminal half of the structure is multihelical
  7. 729176Species Human (Homo sapiens) [TaxId:9606] [55504] (5 PDB entries)
  8. 729179Domain d1y8ja1: 1y8j A:54-749 [122752]
    automatically matched to d1dmta_
    complexed with act, nag, sts, zn

Details for d1y8ja1

PDB Entry: 1y8j (more details), 2.25 Å

PDB Description: crystal structure of human nep complexed with an imidazo[4,5- c]pyridine inhibitor
PDB Compounds: (A:) Neprilysin

SCOP Domain Sequences for d1y8ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y8ja1 d.92.1.4 (A:54-749) Neutral endopeptidase (neprilysin) {Human (Homo sapiens) [TaxId: 9606]}
gickssdciksaarliqnmdattepctdffkyacggwlkrnvipetssrygnfdilrdel
evvlkdvlqepktedivavqkakalyrscinesaidsrggepllkllpdiygwpvatenw
eqkygaswtaekaiaqlnskygkkvlinlfvgtddknsvnhvihidqprlglpsrdyyec
tgiykeactayvdfmisvarlirqeerlpidenqlalemnkvmelekeianatakpedrn
dpmllynkmtlaqiqnnfsleingkpfswlnftneimstvnisitneedvvvyapeyltk
lkpiltkysardlqnlmswrfimdlvsslsrtykesrnafrkalygttsetatwrrcany
vngnmenavgrlyveaafageskhvvedliaqirevfiqtlddltwmdaetkkraeekal
aikerigypddivsndnklnneylelnykedeyfeniiqnlkfsqskqlkklrekvdkde
wisgaavvnafyssgrnqivfpagilqppffsaqqsnslnyggigmvigheithgfddng
rnfnkdgdlvdwwtqqsasnfkeqsqcmvyqygnfswdlaggqhlngintlgeniadngg
lgqayrayqnyikkngeekllpgldlnhkqlfflnfaqvwcgtyrpeyavnsiktdvhsp
gnfriigtlqnsaefseafhcrknsymnpekkcrvw

SCOP Domain Coordinates for d1y8ja1:

Click to download the PDB-style file with coordinates for d1y8ja1.
(The format of our PDB-style files is described here.)

Timeline for d1y8ja1: