Lineage for d1y8ja_ (1y8j A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529210Family d.92.1.4: Neutral endopeptidase (neprilysin) [55502] (2 proteins)
  6. 2529211Protein Neutral endopeptidase (neprilysin) [55503] (1 species)
    contains thermolysin-like catalytic domain (residues 419-749)
    the N-terminal half of the structure is multihelical
  7. 2529212Species Human (Homo sapiens) [TaxId:9606] [55504] (8 PDB entries)
    Uniprot P08473 54-749
  8. 2529216Domain d1y8ja_: 1y8j A: [122752]
    automated match to d1dmta_
    complexed with act, nag, sts, zn

Details for d1y8ja_

PDB Entry: 1y8j (more details), 2.25 Å

PDB Description: Crystal Structure of human NEP complexed with an imidazo[4,5-c]pyridine inhibitor
PDB Compounds: (A:) Neprilysin

SCOPe Domain Sequences for d1y8ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y8ja_ d.92.1.4 (A:) Neutral endopeptidase (neprilysin) {Human (Homo sapiens) [TaxId: 9606]}
gickssdciksaarliqnmdattepctdffkyacggwlkrnvipetssrygnfdilrdel
evvlkdvlqepktedivavqkakalyrscinesaidsrggepllkllpdiygwpvatenw
eqkygaswtaekaiaqlnskygkkvlinlfvgtddknsvnhvihidqprlglpsrdyyec
tgiykeactayvdfmisvarlirqeerlpidenqlalemnkvmelekeianatakpedrn
dpmllynkmtlaqiqnnfsleingkpfswlnftneimstvnisitneedvvvyapeyltk
lkpiltkysardlqnlmswrfimdlvsslsrtykesrnafrkalygttsetatwrrcany
vngnmenavgrlyveaafageskhvvedliaqirevfiqtlddltwmdaetkkraeekal
aikerigypddivsndnklnneylelnykedeyfeniiqnlkfsqskqlkklrekvdkde
wisgaavvnafyssgrnqivfpagilqppffsaqqsnslnyggigmvigheithgfddng
rnfnkdgdlvdwwtqqsasnfkeqsqcmvyqygnfswdlaggqhlngintlgeniadngg
lgqayrayqnyikkngeekllpgldlnhkqlfflnfaqvwcgtyrpeyavnsiktdvhsp
gnfriigtlqnsaefseafhcrknsymnpekkcrvw

SCOPe Domain Coordinates for d1y8ja_:

Click to download the PDB-style file with coordinates for d1y8ja_.
(The format of our PDB-style files is described here.)

Timeline for d1y8ja_: