Lineage for d1y8id_ (1y8i D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687104Species Horse (Equus caballus) [TaxId:9796] [46504] (19 PDB entries)
  8. 2687117Domain d1y8id_: 1y8i D: [122751]
    Other proteins in same PDB: d1y8ia_, d1y8ic_
    automated match to d1g0bb_
    complexed with hem

Details for d1y8id_

PDB Entry: 1y8i (more details), 2.6 Å

PDB Description: Horse methemoglobin low salt, PH 7.0 (98% relative humidity)
PDB Compounds: (D:) hemoglobin beta chain

SCOPe Domain Sequences for d1y8id_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y8id_ a.1.1.2 (D:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

SCOPe Domain Coordinates for d1y8id_:

Click to download the PDB-style file with coordinates for d1y8id_.
(The format of our PDB-style files is described here.)

Timeline for d1y8id_: