![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (24 species) |
![]() | Species Horse (Equus caballus) [TaxId:9796] [46488] (17 PDB entries) |
![]() | Domain d1y8ic_: 1y8i C: [122750] Other proteins in same PDB: d1y8ib_, d1y8id_ automated match to d1g0ba_ complexed with hem |
PDB Entry: 1y8i (more details), 2.6 Å
SCOPe Domain Sequences for d1y8ic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y8ic_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]} vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa vhasldkflssvstvltskyr
Timeline for d1y8ic_: