Lineage for d1y8ic_ (1y8i C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1254022Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1254115Species Horse (Equus caballus) [TaxId:9796] [46488] (16 PDB entries)
  8. 1254129Domain d1y8ic_: 1y8i C: [122750]
    Other proteins in same PDB: d1y8ib_, d1y8id_
    automated match to d1g0ba_
    complexed with hem

Details for d1y8ic_

PDB Entry: 1y8i (more details), 2.6 Å

PDB Description: Horse methemoglobin low salt, PH 7.0 (98% relative humidity)
PDB Compounds: (C:) Hemoglobin alpha chains

SCOPe Domain Sequences for d1y8ic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y8ic_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOPe Domain Coordinates for d1y8ic_:

Click to download the PDB-style file with coordinates for d1y8ic_.
(The format of our PDB-style files is described here.)

Timeline for d1y8ic_: