Lineage for d1y8ia_ (1y8i A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686340Species Horse (Equus caballus) [TaxId:9796] [46488] (19 PDB entries)
  8. 2686352Domain d1y8ia_: 1y8i A: [122748]
    Other proteins in same PDB: d1y8ib_, d1y8id_
    automated match to d1g0ba_
    complexed with hem

Details for d1y8ia_

PDB Entry: 1y8i (more details), 2.6 Å

PDB Description: Horse methemoglobin low salt, PH 7.0 (98% relative humidity)
PDB Compounds: (A:) Hemoglobin alpha chains

SCOPe Domain Sequences for d1y8ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y8ia_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOPe Domain Coordinates for d1y8ia_:

Click to download the PDB-style file with coordinates for d1y8ia_.
(The format of our PDB-style files is described here.)

Timeline for d1y8ia_: