![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (22 species) |
![]() | Species Horse (Equus caballus) [TaxId:9796] [46504] (10 PDB entries) |
![]() | Domain d1y8hd1: 1y8h D:1-146 [122747] Other proteins in same PDB: d1y8ha1, d1y8hc1 automatically matched to d1g0bb_ complexed with hem |
PDB Entry: 1y8h (more details), 3.1 Å
SCOP Domain Sequences for d1y8hd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y8hd1 a.1.1.2 (D:1-146) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]} vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk dftpelqasyqkvvagvanalahkyh
Timeline for d1y8hd1: