Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (26 species) |
Species Horse (Equus caballus) [TaxId:9796] [46504] (19 PDB entries) |
Domain d1y8hd_: 1y8h D: [122747] Other proteins in same PDB: d1y8ha_, d1y8hc_ automated match to d1s0hb1 complexed with hem |
PDB Entry: 1y8h (more details), 3.1 Å
SCOPe Domain Sequences for d1y8hd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y8hd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]} vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk dftpelqasyqkvvagvanalahkyh
Timeline for d1y8hd_: