Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (24 species) |
Species Horse (Equus caballus) [TaxId:9796] [46488] (19 PDB entries) |
Domain d1y8hc_: 1y8h C: [122746] Other proteins in same PDB: d1y8hb_, d1y8hd_ automated match to d1ns9a_ complexed with hem |
PDB Entry: 1y8h (more details), 3.1 Å
SCOPe Domain Sequences for d1y8hc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y8hc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]} vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa vhasldkflssvstvltskyr
Timeline for d1y8hc_: