Lineage for d1y8hc_ (1y8h C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686340Species Horse (Equus caballus) [TaxId:9796] [46488] (19 PDB entries)
  8. 2686360Domain d1y8hc_: 1y8h C: [122746]
    Other proteins in same PDB: d1y8hb_, d1y8hd_
    automated match to d1ns9a_
    complexed with hem

Details for d1y8hc_

PDB Entry: 1y8h (more details), 3.1 Å

PDB Description: horse methemoglobin low salt, ph 7.0
PDB Compounds: (C:) Hemoglobin alpha chains

SCOPe Domain Sequences for d1y8hc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y8hc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOPe Domain Coordinates for d1y8hc_:

Click to download the PDB-style file with coordinates for d1y8hc_.
(The format of our PDB-style files is described here.)

Timeline for d1y8hc_: