SCOPe 2.05: Domain d1y82d_: 1y82 D:

Lineage for d1y82d_ (1y82 D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (3 families)

5. Family c.120.1.1: PIN domain [89619] (7 proteins)
   Pfam PF01850

6. Protein Hypothetical protein PF0355 [142116] (1 species)
   PH0500 ortholog

7. Species Pyrococcus furiosus [TaxId:2261] [142117] (1 PDB entry)
   Uniprot Q8U3V0 2-148

8. Domain d1y82d_: 1y82 D: [122735]
   automated match to d1y82a1
   complexed with unx

Details for d1y82d_

PDB Entry: 1y82, 2.3 Å

PDB Description: conserved hypothetical protein pfu-367848-001 from pyrococcus furiosus

PDB Compounds: (D:) hypothetical protein

SCOPe Domain Sequences for d1y82d_:

Sequence; same for both SEQRES and ATOM records:

>d1y82d_ c.120.1.1 (D:) Hypothetical protein PF0355 {Pyrococcus furiosus [TaxId: 2261]}
lppditfdslalikmhsqsmkkileitlakftvnlsivtvyryltvraylkknieleldv
lkdiynivplneeiaikaaqieadlmrkgmmpdiedvltaataiytksllitddskryep
mrrfgldtmpldkfvkeve

Timeline for d1y82d_:

• d1y82d_ first appeared in SCOP 1.73, called d1y82d1
  
• d1y82d_ appears in SCOPe 2.04
  
• d1y82d_ appears in SCOPe 2.06
  
• d1y82d_ appears in the current release, SCOPe 2.08