Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (3 families) |
Family c.120.1.1: PIN domain [89619] (7 proteins) Pfam PF01850 |
Protein Hypothetical protein PF0355 [142116] (1 species) PH0500 ortholog |
Species Pyrococcus furiosus [TaxId:2261] [142117] (1 PDB entry) Uniprot Q8U3V0 2-148 |
Domain d1y82d_: 1y82 D: [122735] automated match to d1y82a1 complexed with unx |
PDB Entry: 1y82 (more details), 2.3 Å
SCOPe Domain Sequences for d1y82d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y82d_ c.120.1.1 (D:) Hypothetical protein PF0355 {Pyrococcus furiosus [TaxId: 2261]} lppditfdslalikmhsqsmkkileitlakftvnlsivtvyryltvraylkknieleldv lkdiynivplneeiaikaaqieadlmrkgmmpdiedvltaataiytksllitddskryep mrrfgldtmpldkfvkeve
Timeline for d1y82d_: