Lineage for d1y82c1 (1y82 C:3-148)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712940Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 712941Superfamily c.120.1: PIN domain-like [88723] (2 families) (S)
  5. 712942Family c.120.1.1: PIN domain [89619] (7 proteins)
    Pfam PF01850
  6. 712974Protein Hypothetical protein PF0355 [142116] (1 species)
    PH0500 ortholog
  7. 712975Species Pyrococcus furiosus [TaxId:2261] [142117] (1 PDB entry)
  8. 712978Domain d1y82c1: 1y82 C:3-148 [122734]
    automatically matched to 1Y82 A:2-148
    complexed with unx

Details for d1y82c1

PDB Entry: 1y82 (more details), 2.3 Å

PDB Description: conserved hypothetical protein pfu-367848-001 from pyrococcus furiosus
PDB Compounds: (C:) hypothetical protein

SCOP Domain Sequences for d1y82c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y82c1 c.120.1.1 (C:3-148) Hypothetical protein PF0355 {Pyrococcus furiosus [TaxId: 2261]}
lppditfdslalikmhsqsmkkileitlakftvnlsivtvyryltvraylkknieleldv
lkdiynivplneeiaikaaqieadlmrkgmmpdiedvltaataiytksllitddskryep
mrrfgldtmpldkfvkevelmvekel

SCOP Domain Coordinates for d1y82c1:

Click to download the PDB-style file with coordinates for d1y82c1.
(The format of our PDB-style files is described here.)

Timeline for d1y82c1: