Lineage for d1y81a1 (1y81 A:6-121)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830310Family c.2.1.8: CoA-binding domain [51900] (6 proteins)
  6. 1830315Protein Hypothetical protein PF0725 [141938] (1 species)
  7. 1830316Species Pyrococcus furiosus [TaxId:2261] [141939] (1 PDB entry)
    Uniprot Q8U2V3 6-121
  8. 1830317Domain d1y81a1: 1y81 A:6-121 [122731]
    complexed with coa, scn, unx

Details for d1y81a1

PDB Entry: 1y81 (more details), 1.7 Å

PDB Description: conserved hypothetical protein pfu-723267-001 from pyrococcus furiosus
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1y81a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]}
frkialvgasknpakygniilkdllskgfevlpvnpnydeieglkcyrsvrelpkdvdvi
vfvvppkvglqvakeaveagfkklwfqpgaeseeirrflekagveysfgrcimvet

SCOPe Domain Coordinates for d1y81a1:

Click to download the PDB-style file with coordinates for d1y81a1.
(The format of our PDB-style files is described here.)

Timeline for d1y81a1: